Mouse PR3/PRTN3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse spleen using 86384-3-RR (same clone as 86384-3-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 86384-3-RR (Prtn3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86384-3-PBS in a different storage buffer formulation.

• 

  WB analysis of rat spleen using 86384-3-RR (same clone as 86384-3-PBS)

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 86384-3-RR (Prtn3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86384-3-PBS in a different storage buffer formulation.

PR3/PRTN3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86384-3-PBS

Clone No.250371B12

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Myeloblastin, PR3, PR-3, Proteinase 3, PRTN3

---

Product Information

86384-3-PBS targets PR3/PRTN3 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2750

  Product name: recombinant mouse Prtn3 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 28-250 aa of NM_011178.2

  Sequence: SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLLQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVTFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDWIQNVLR

• Full Name: proteinase 3
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: NM_011178.2
• Gene Symbol: Prtn3
• Gene ID (NCBI): 19152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61096
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.