PRAM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PRAM1 Polyclonal antibody (13651-1-AP)

PRAM1 Polyclonal Antibody for WB, ELISA

Cat No. 13651-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

PML RAR, PRAM 1, PRAM1

• 

  WB analysis of U-937 using 13651-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 13651-1-AP (PRAM1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PRAM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13651-1-AP targets PRAM1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4162

  Product name: Recombinant human PRAM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-299 aa of BC028012

  Sequence: MAHHLPAAMENHQDFRSIKAKFQASQPEPSDLPKKPPKPEFGKLKKFSQPELSEHPKKAPLPEFGAVSLKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPSKLELSDLSKKFPQLGATPFPRKPLQPEVGEAPLKASLPEPGAPARKPLQPDELSHPARPPSEPKSGAFPRKLWQPEAGEATPRSPQPELSTFPKKPAQPEFNVYPKKPPQPQVGGLPKKSVPQPEFSEAAQTPLWKPQSSEPKRDSSAFPKKASQPPLSDFPKKPPQPELGDLTRTSSE

• Full Name: PML-RARA regulated adaptor molecule 1
• Calculated Molecular Weight: 718 aa, 79 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC028012
• Gene Symbol: PRAM1
• Gene ID (NCBI): 84106
• RRID: AB_2877964
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QH2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRAM1, also named as PML-RARA-regulated adapter molecule 1, is a 718 amino acid protein, which contains 1 SH3 domain. PRAM1 is expressed in peripheral blood leukocytes and bone marrow. It is not expressed in non hematopoietic tissues except in lung. PRAM1 may be involved in myeloid differentiation and integrin signaling in neutrophils.

Publications

What published studies show

The PRAM1 Polyclonal Antibody (Cat# 13651-1-AP) has 1 citation to date. It was cited in Discover Oncology (2026) in a study on lactylation-related gene signatures for prognosis prediction and immune infiltration assessment in lung adenocarcinoma using bulk and single-cell RNA sequencing. The antibody was applied in Western Blot (WB) with human samples. The associated research field is oncology, specifically lung adenocarcinoma and immune microenvironment analysis.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Discov Oncol; Lactylation-related gene signature for prognosis prediction and immune infiltration assessment in lung adenocarcinoma via bulk and single-cell RNA sequencing.; Authors - Hua Zhou