PRC1 Polyclonal antibody

• 

  WB analysis of MCF-7 using 10110-2-AP

  WB result of PRC1 antibody (10110-2-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PRC1 transfected MCF-7 cells.

• 

  WB analysis using 10110-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10110-2-AP (PRC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 10110-2-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10110-2-AP (PRC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 10110-2-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10110-2-AP (PRC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PRC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10110-2-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

ASE1, PRC1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

10110-2-AP targets PRC1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0163

  Product name: Recombinant human PRC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-175 aa of BC005140

  Sequence: VCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFV

• Full Name: protein regulator of cytokinesis 1
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC005140
• Gene Symbol: PRC1
• Gene ID (NCBI): 9055
• RRID: AB_2252888
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43663
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRC1 is involved in cytokinesis. PRC1 is at high level during S and G2/M and drop dramatically after cell exit mitosis and enter G1. PRC1 is located in the nucleus during interphase, and becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. PRC1 is a good substrate for several cyclin-dependent kinases (CDKs) in vitro and is phosphorylated in vivo at sites that are phosphorylated by CDK in vitro, suggesting that PRC1 is an in vivo CDK substrate.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Immun Inflamm Dis; E2F3 renders an immunosuppressive tumor microenvironment in nasopharyngeal carcinoma: Involvements of the transcription activation of PRC1 and BIRC5; Authors - Qiang Wang