PRDM4 Polyclonal antibody

• 

  WB analysis of mouse pancreas using 13792-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 13792-1-AP (PRDM4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 13792-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 13792-1-AP (PRDM4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

PRDM4 Polyclonal Antibody for WB, ELISA

Cat No. 13792-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PFM1, PR domain containing 4, PR domain containing protein 4, PRDM4

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13792-1-AP targets PRDM4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4580

  Product name: Recombinant human PRDM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 451-801 aa of BC035581

  Sequence: EVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMCPQAFISPSKLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKNYRCTLCDKSFTQKAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCDKLFLRTNHLKKHLNSHEGKRDYVCEKCTKAYLTKYHLTRHLKTCKGPTSSSSAPEEEEEDDSEEEDLADSVGTEDCRINSAVYSADESLSAHK

• Full Name: PR domain containing 4
• Calculated Molecular Weight: 801 aa, 88 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC035581
• Gene Symbol: PRDM4
• Gene ID (NCBI): 11108
• RRID: AB_10638307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKN5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PRDM family members are characterized by the presence of a PR (positive regulatory) domain and multiple zinc finger (ZnFg) domains. The PR domain defines a family of transcription factors involved in cell differentiation and tumorigenesis. PRDM proteins are either epigenetic modifiers in their own right or else they recruit third party chromatin modifiers - e.g. histone deacetylases (HDACs), histone lysine MTases or histone arginine MTases - to regulate cell type-specific gene expression in various tissues (PRDM4 as an HDAC-associated transcriptional repressor that modulates cell cycle progression.