PRDM4 Polyclonal antibody

PRDM4 Polyclonal Antibody for WB, ELISA
Cat No. 13792-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

PFM1, PR domain containing 4, PR domain containing protein 4, PRDM4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse pancreas tissue, COLO 320 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13792-1-AP targets PRDM4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4580

Product name: Recombinant human PRDM4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 451-801 aa of BC035581

Sequence: EVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMCPQAFISPSKLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKNYRCTLCDKSFTQKAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCDKLFLRTNHLKKHLNSHEGKRDYVCEKCTKAYLTKYHLTRHLKTCKGPTSSSSAPEEEEEDDSEEEDLADSVGTEDCRINSAVYSADESLSAHK

Predict reactive species
Full Name PR domain containing 4
Calculated Molecular Weight 801 aa, 88 kDa
Observed Molecular Weight 88 kDa
GenBank Accession NumberBC035581
Gene Symbol PRDM4
Gene ID (NCBI) 11108
RRIDAB_10638307
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UKN5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PRDM family members are characterized by the presence of a PR (positive regulatory) domain and multiple zinc finger (ZnFg) domains. The PR domain defines a family of transcription factors involved in cell differentiation and tumorigenesis. PRDM proteins are either epigenetic modifiers in their own right or else they recruit third party chromatin modifiers - e.g. histone deacetylases (HDACs), histone lysine MTases or histone arginine MTases - to regulate cell type-specific gene expression in various tissues (PRDM4 as an HDAC-associated transcriptional repressor that modulates cell cycle progression.

Protocols

Product Specific Protocols
WB protocol for PRDM4 antibody 13792-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...