• Featured Product
  • KD/KO Validated

Peroxiredoxin 2 Monoclonal antibody

Peroxiredoxin 2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 60202-1-Ig
Clone No.3H6C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

PRDX2, 3H6C4, EC:1.11.1.24, Natural killer cell-enhancing factor B, NKEFB

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, human testis tissue, fetal human brain tissue, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells
Positive IHC detected inhuman testis tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60202-1-Ig targets Peroxiredoxin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0835

Product name: Recombinant human PRDX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-198 aa of BC003022

Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Predict reactive species
Full Name peroxiredoxin 2
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC003022
Gene Symbol peroxiredoxin 2
Gene ID (NCBI) 7001
RRIDAB_10918978
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP32119
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRDX2, also named as TSA, PRP, NKEFB and TDPX1, belongs to the ahpC/TSA family. It is known to act as an antioxidant enzyme whose main function is H2O2 reduction in cells. PRDX2 is involved in redox regulation of the cell. It reduces peroxides with reducing equivalents provided through the thioredoxin system. It may play an important role in eliminating peroxides generated during metabolism. PRDX2 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. PRDX2 actions may be related to the expression of NFKB and IKB.(PMID:21248284)

Protocols

Product Specific Protocols
WB protocol for Peroxiredoxin 2 antibody 60202-1-IgDownload protocol
IHC protocol for Peroxiredoxin 2 antibody 60202-1-IgDownload protocol
IF protocol for Peroxiredoxin 2 antibody 60202-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC,IF

J Exp Clin Cancer Res

Compound kushen injection suppresses human acute myeloid leukaemia by regulating the Prdxs/ROS/Trx1 signalling pathway.

Authors - Yanxia Jin
humanWB

Cancer Manag Res

siPRDX2-elevated DNM3 inhibits the proliferation and metastasis of colon cancer cells via AKT signaling pathway.

Authors - Yini Ma
  • KD Validated
humanWB

Oncol Lett

PRDX2 protects hepatocellular carcinoma SMMC-7721 cells from oxidative stress.

Authors - Silei Zhou
humanIF

Cell Death Dis

PRDX2 promotes the proliferation of colorectal cancer cells by increasing the ubiquitinated degradation of p53.

Authors - Wuyi Wang
  • KD Validated
humanWB

Curr Issues Mol Biol

Peroxiredoxins and Hypoxia-Inducible Factor-1α in Duodenal Tissue: Emerging Factors in the Pathophysiology of Pediatric Celiac Disease Patients

Authors - Fadime Aydın Köse
Loading...
||
New chat Able
正在加载,请稍候...