Perforin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Perforin Polyclonal antibody (14580-1-AP)

Perforin Polyclonal Antibody for WB, ELISA

Cat No. 14580-1-AP Copied!

Publications (26)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Cytolysin, FLH2, HPLH2, Lymphocyte pore-forming protein, P1

• 

  WB analysis using 14580-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14580-1-AP (Perforin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Perforin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: CTLL-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14580-1-AP targets Perforin in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6060

  Product name: Recombinant human Perforin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 247-555 aa of BC063043

  Sequence: EGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW

• Full Name: perforin 1 (pore forming protein)
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC063043
• Gene Symbol: Perforin
• Gene ID (NCBI): 5551
• RRID: AB_10639524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14222
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Perforin 1 (PRF1) is one of the major cytolytic proteins of cytolytic granules. It is known to be a crucial effector molecule in cytolytic T lymphocyte and natural killer cell-mediated cytotoxicity. This protein has structural and functional similarities to complement component C9. Like C9, this protein creates transmembrane tubules and is capable of lysing nonspecifically a variety of target cells. Defects in PRF1 are the cause of familial hemophagocytic lymphohistiocytosis type 2 (FHL2), which is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. (PMID: 2417226; 7774276; 2783486; 10583959)

Publications

What published studies show

The Perforin polyclonal antibody (Cat# 14580-1-AP) has accumulated 26 citations published in journals including Cancer Cell, Cell Metabolism, Neuron, Cell Reports, iScience, Frontiers in Immunology, Molecular Immunology, European Journal of Pharmacology, International Immunopharmacology, Biochimica et Biophysica Acta, and Developmental and Comparative Immunology. Associated research fields encompass cancer immunotherapy, NK cell cytotoxicity, T-cell immune responses, immune checkpoint blockade, tumor microenvironment, liver fibrosis, and comparative immunology.

Automatically generated from the 26 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; B cells disrupt tertiary lymphoid structure formation and suppress anti-tumor immunity.; Authors - Changhao Chen
		Cell Metab; HEBP2-governed glutamine competition between tumor and macrophages dictates immunotherapy efficacy in triple-negative breast cancer; Authors - Yi Xiao
human	IHC	Neuron; Metabolic reprogramming through histone lactylation in microglia and macrophages recruits CD8+ T lymphocytes and aggravates spinal cord injury; Authors - Xuhui Ge
	IF	J Exp Clin Cancer Res; Targeting MUS81 promotes the anticancer effect of WEE1 inhibitor and immune checkpoint blocking combination therapy via activating cGAS/STING signaling in gastric cancer cells.; Authors - Chengguo Li
	IF	Cell Rep Med; Circulating natural killer cells are phenotypically and functionally altered in age-related macular degeneration.; Authors - Kiva Brennan
	IHC	Carbohydr Polym; Structural characterization and antitumor activity via immune modulation of an α-glucan from Grifola frondosa.; Authors - Hui-Xiang Tian