Perforin Polyclonal antibody

• 

  WB analysis using 14580-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14580-1-AP (Perforin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 14580-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14580-1-AP (PRF1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

Perforin Polyclonal Antibody for WB, ELISA

Cat No. 14580-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Cytolysin, FLH2, HPLH2, Lymphocyte pore-forming protein, P1

---

Tested Applications

• Positive WB detected in: CTLL-2 cells, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 2 publications below
• IF: See 4 publications below

Product Information

14580-1-AP targets Perforin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6060

  Product name: Recombinant human Perforin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 247-555 aa of BC063043

  Sequence: EGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW

• Full Name: perforin 1 (pore forming protein)
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC063043
• Gene Symbol: Perforin
• Gene ID (NCBI): 5551
• RRID: AB_10639524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14222
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Perforin 1 (PRF1) is one of the major cytolytic proteins of cytolytic granules. It is known to be a crucial effector molecule in cytolytic T lymphocyte and natural killer cell-mediated cytotoxicity. This protein has structural and functional similarities to complement component C9. Like C9, this protein creates transmembrane tubules and is capable of lysing nonspecifically a variety of target cells. Defects in PRF1 are the cause of familial hemophagocytic lymphohistiocytosis type 2 (FHL2), which is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. (PMID: 2417226; 7774276; 2783486; 10583959)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Front Cell Infect Microbiol; The Role of Tim-3 on dNK Cells Dysfunction During Abnormal Pregnancy With Toxoplasma gondii Infection.; Authors - Teng Li
human	WB	Mol Immunol; VEGF165b augments NK92 cytolytic activity against human K562 leukemia cells by upregulating the levels of perforin and granzyme B via the VEGR1-PLC pathway.; Authors - Xiaoyin Wang
chicken	WB	Res Vet Sci; Characterization of cytotoxicity-related gene expression in response to virulent Marek's disease virus infection in the bursa of Fabricius.; Authors - Cui-Ying Chen
mouse	IF	J Exp Clin Cancer Res; Targeting MUS81 promotes the anticancer effect of WEE1 inhibitor and immune checkpoint blocking combination therapy via activating cGAS/STING signaling in gastric cancer cells.; Authors - Chengguo Li
mouse	IF	Biomed Pharmacother; Tannins in Terminalia bellirica inhibits hepatocellular carcinoma growth via re-educating tumor-associated macrophages and restoring CD8+T cell function; Authors - Zihao Chang
human	WB	J Immunol Res; The SIX1/LDHA Axis Promotes Lactate Accumulation and Leads to NK Cell Dysfunction in Pancreatic Cancer; Authors - Wanli Ge