Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, NIH/3T3 cells, J774A.1 cells, RAW 264.7 cells, PC-12 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10929-2-AP targets AMPK Alpha in WB, IHC, IF/ICC, IP, ChIP, ELISA, Western Blot applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig, chicken, bovine, goat, fish, carp, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1367 Product name: Recombinant human AMPK alpha protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC012622 Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH Predict reactive species |
| Full Name | protein kinase, AMP-activated, alpha 1 catalytic subunit |
| Calculated Molecular Weight | 63 kDa |
| Observed Molecular Weight | 64 kDa |
| GenBank Accession Number | BC012622 |
| Gene Symbol | AMPK Alpha 1 |
| Gene ID (NCBI) | 5562 |
| RRID | AB_2169568 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13131 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing.10929-2-AP can recognize both AMPK Alpha 1 and AMPK Alpha 2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMPK Alpha antibody 10929-2-AP | Download protocol |
| IHC protocol for AMPK Alpha antibody 10929-2-AP | Download protocol |
| IP protocol for AMPK Alpha antibody 10929-2-AP | Download protocol |
| WB protocol for AMPK Alpha antibody 10929-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-AMPK antibody (Cat# 10929-2-AP) has accumulated 471 total citations published in high-impact journals including Nature, Cell Metabolism, Nature Communications, Autophagy, Advanced Science, Free Radical Biology and Medicine, Phytomedicine, Journal of Agricultural and Food Chemistry, and Cell Death & Disease. Research fields span lipid and glucose metabolism, autophagy/mitophagy, ferroptosis, cardiac injury, liver disease (NAFLD/NASH), cancer, diabetic complications, neurodegeneration, oxidative stress, inflammation, bone/cartilage degeneration, environmental toxicology, and food science.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Glibenclamide targets MDH2 to relieve aging phenotypes through metabolism-regulated epigenetic modification | ||
Cell Metab Semaglutide ameliorates osteoarthritis progression through a weight loss-independent metabolic restoration mechanism. | ||
Cell Metab Macrophage PD-1 regulates energy expenditure and metabolic dysfunction under immune checkpoint blockade. |
Reviews
What customers say
Users consistently rate this antibody highly (average ~4.8/5 across 12 reviews). It performs well in Western Blot and Immunofluorescence across diverse samples including U2OS, HeLa, Caco2, NIH-3T3, leukemia cells, mouse heart tissue, and mouse colon. Reviewers report a clear single band at the expected ~60 kDa molecular weight. Recommended dilutions range from 1:500 to 1:10,000 depending on application. Minor concerns include some background when using milk as blocking buffer and one user needing a higher concentration than suggested for IF. Overall, users describe it as an excellent, reliable antibody.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mallikarjun (Verified Customer) (02-04-2026) | Works very well
|
MANOBENDRO NATH (Verified Customer) (11-07-2025) | Excellent antibody!
|
MANOBENDRO NATH (Verified Customer) (10-09-2025) | Very nice antibody.
 |
Nishita (Verified Customer) (09-12-2025) | Worked pretty well, but we had to use a more concentrated dilution than the one recommended by the site.
|
Priya (Verified Customer) (10-03-2024) | Used this antibody for colon carcinoma cell line and mice tissue
|
Charlotte (Verified Customer) (08-15-2024) | Done in milk but got quite some background. I tried in seablock but not sure it helps. Otherwise nice antibody with one intense band at the expected MW
 |
Priya (Verified Customer) (06-21-2023) | Used this antibody for Caco2 cells andmice tissue
|
Priya (Verified Customer) (06-21-2023) | Used this antibody for Caco2 cells andmice tissue
|
LUNFENG (Verified Customer) (01-27-2020) | GOOD
|
Jing (Verified Customer) (01-27-2020) | tested in mouse heart lysate, with clear single band around 60 kd.
|
Jie (Verified Customer) (01-27-2020) | showed a single band at the correct size with mouse heart tissue section
|
Yan (Verified Customer) (01-03-2020) | We tested this antibody in mouse heart tissue extract. It worked very well and showed a single band around 60kDa.
|
