AMPK Beta 2 Polyclonal antibody

AMPK Beta 2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 14429-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

PRKAB2, 5'-AMP-activated protein kinase subunit beta-2, AMPK, AMPK subunit beta 2, AMPK subunit beta-2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, human heart tissue, human brain tissue, fetal human brain tissue, mouse testis tissue, mouse brain tissue, rat brain tissue
Positive IHC detected inhuman colon tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14429-1-AP targets AMPK Beta 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5806

Product name: Recombinant human PRKAB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-272 aa of BC053610

Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

Predict reactive species
Full Name protein kinase, AMP-activated, beta 2 non-catalytic subunit
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC053610
Gene Symbol AMPK Beta 2
Gene ID (NCBI) 5565
RRIDAB_2252925
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43741
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AMPK beta 2 is a regulatory subunit of the AMP-activated protein kinase (AMPK), which is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK beta 2 may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles.

Protocols

Product Specific Protocols
WB protocol for AMPK Beta 2 antibody 14429-1-APDownload protocol
IHC protocol for AMPK Beta 2 antibody 14429-1-APDownload protocol
IF protocol for AMPK Beta 2 antibody 14429-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

YINGJIAN (Verified Customer) (08-15-2025)

high specificity, strong/robust signal, low background, consistent results, reproducible performance, good lot-to-lot consistency

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: heart
AMPK Beta 2 Antibody Western Blot validation (1:5000 dilution) in heart (Cat no:14429-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...