Tested Applications
| Positive WB detected in | HEK-293 cells, human heart tissue, human brain tissue, fetal human brain tissue, mouse testis tissue, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human colon tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14429-1-AP targets AMPK Beta 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5806 Product name: Recombinant human PRKAB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC053610 Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI Predict reactive species |
| Full Name | protein kinase, AMP-activated, beta 2 non-catalytic subunit |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC053610 |
| Gene Symbol | AMPK Beta 2 |
| Gene ID (NCBI) | 5565 |
| RRID | AB_2252925 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43741 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AMPK beta 2 is a regulatory subunit of the AMP-activated protein kinase (AMPK), which is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK beta 2 may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMPK Beta 2 antibody 14429-1-AP | Download protocol |
| IHC protocol for AMPK Beta 2 antibody 14429-1-AP | Download protocol |
| WB protocol for AMPK Beta 2 antibody 14429-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AMPK Beta 2 Polyclonal antibody (Cat# 14429-1-AP) has 1 citation, published in Autophagy (IF 18.6). The study investigates PRKAB2 as a tumor suppressor in renal cell carcinoma, focusing on mitophagy inhibition via the LRPPRC-PRKN/parkin interaction and cardiolipin biosynthesis. The antibody was validated by WB and IHC in human samples. Associated research fields include cancer biology (renal cell carcinoma), autophagy/mitophagy, and metabolic regulation.
| Species | Application | Title |
|---|---|---|
Autophagy PRKAB2 as a tumor suppressor in renal cell carcinoma: inhibiting mitophagy via the LRPPRC-PRKN/parkin interaction and cardiolipin biosynthesis.
|
Reviews
What customers say
The single review for this product highlights excellent performance in Western Blot. The reviewer reported high specificity, a strong and robust signal, and low background. They also noted consistent, reproducible results with good lot-to-lot consistency. The antibody was used at a 1:5000 dilution on heart tissue and received a 5-star rating. Overall, the feedback is highly positive, emphasizing reliability and reproducibility.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
YINGJIAN (Verified Customer) (08-15-2025) | high specificity, strong/robust signal, low background, consistent results, reproducible performance, good lot-to-lot consistency
 |
