PRKACG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRKACG Polyclonal antibody, PBS Only (13697-1-PBS)

• 

  WB analysis using 13697-1-AP (same clone as 13697-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13697-1-AP (PRKACG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13697-1-PBS in a different storage buffer formulation.

PRKACG Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13697-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13697-1-PBS targets PRKACG in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4595

  Product name: Recombinant human PRKACG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC039888

  Sequence: MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCPKEFSEF

• Full Name: protein kinase, cAMP-dependent, catalytic, gamma
• Calculated Molecular Weight: 351 aa, 40 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC039888
• Gene Symbol: PRKACG
• Gene ID (NCBI): 5568
• RRID: AB_3085421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22612
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.