PRKCB Monoclonal antibody, PBS Only

PRKCB Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68620-1-PBS
Clone No.4B7A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, Indirect ELISA

PKC beta, 4B7A1, EC:2.7.11.13, pan-PKC, PKC B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68620-1-PBS targets PRKCB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33693

Product name: Recombinant human PRKCB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 342-598 aa of BC036472

Sequence: FNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHA

Predict reactive species
Full Name protein kinase C, beta
Calculated Molecular Weight 673 aa, 77 kDa
Observed Molecular Weight 77 kDa
GenBank Accession NumberBC036472
Gene Symbol PRKCB
Gene ID (NCBI) 5579
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP05771
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. Protein kinase Cs (PKCs) are signaling molecules that play key roles in many cellular processes, including secretion, gene expression, proliferation, and muscle contraction. The PKC family is broadly divided into three subgroups: classical, novel, and atypical PKCs. These subgroups differ in both protein sequences and mechanistic requirements for catalytic activity. PKC beta is one of the PKC family members. PKC beta has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress.

Loading...
||
New chat

Able

正在加载,请稍候...