PRKRIP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRKRIP1 Polyclonal antibody, PBS Only (16794-1-PBS)

• 

  WB analysis using 16794-1-AP (same clone as 16794-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16794-1-AP (PRKRIP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16794-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16794-1-AP (same clone as 16794-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16794-1-AP (PRKRIP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16794-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NIH/3T3 using 16794-1-AP (same clone as 16794-1-PBS)

  IP result of anti-PRKRIP1 (IP:16794-1-AP, 4ug; Detection:16794-1-AP 1:2000) with NIH/3T3 cells lysate 1200 ug. This data was developed using the same antibody clone with 16794-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 16794-1-AP (same clone as 16794-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16794-1-AP (PRKRIP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16794-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Caco-2 using 16794-1-AP (same clone as 16794-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using PRKRIP1 antibody (16794-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16794-1-PBS in a different storage buffer formulation.

PRKRIP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16794-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

C114, PRKR interacting protein 1, PRKR-interacting protein 1

---

Product Information

16794-1-PBS targets PRKRIP1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10266

  Product name: Recombinant human PRKRIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC014298

  Sequence: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR

• Full Name: PRKR interacting protein 1 (IL11 inducible)
• Calculated Molecular Weight: 184 aa, 21 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: BC014298
• Gene Symbol: PRKRIP1
• Gene ID (NCBI): 79706
• RRID: AB_3741894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H875
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRKR-interacting protein 1 (PRKRIP1), a component of the splicing C complex, is a double-stranded RNA-binding protein. PRKRIP1 consists of a fully extended N-terminal loop (residues 51-75) and an 18-turn α helix (residues 76-142) that spans 100 Å (PMID: 28502770). The full-length cDNA contains an open reading frame of 561 bp, which encodes an 184-amino acid polypeptide with a predicted molecular mass of 21 kDa (PMID: 12679338).