Use Able AI chat for product recommendations

Prolactin Recombinant monoclonal antibody, PBS Only

Prolactin Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 85765-3-PBS
Clone No.242898A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

PRL

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85765-3-PBS targets Prolactin in WB, IHC, IF-P, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9764

Product name: Recombinant human PRL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-227 aa of BC015850

Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Predict reactive species
Full Name prolactin
Calculated Molecular Weight 227 aa, 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC015850
Gene Symbol Prolactin/PRL
Gene ID (NCBI) 5617
RRIDAB_3744358
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01236
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Prolactin is also named as PRL and belongs to the somatotropin/prolactin family. The proteins encoded by PRL are secreted into the cell surroundings. And they are abundantly expressed in pituitary gland, adenohypophysis, decidua and testis. Indeed, chemically, prolactin appears in a multiplicity of posttranslational forms ranging from size variants to chemical modifications such as phosphorylation or glycosylation. It is not only synthesized in the pituitary gland, as originally described, but also within the central nervous system, the immune system, the uterus and its associated tissues of conception, and even the mammary gland itself (PMID: 11015620). Prolactin acts primarily on the mammary gland by promoting lactation (PMID: 30546056). The major form of prolactin found in the pituitary gland is 23 kDa, variants of prolactin have been characterized in many mammals, including humans. Of the cleaved forms that have been characterized, 14 kDa, 16 kDa, and 22 kDa prolactin variants have been most widely studied (PMID: 7937959) (PMID: 8425495).

Loading...
||
New chat

Able

正在加载,请稍候...