Prolactin Recombinant monoclonal antibody, PBS Only (Capture)

Prolactin Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 85765-3-PBS
Clone No.242898A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

PRL

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85765-3-PBS targets Prolactin as part of a matched antibody pair:

MP02083-1: 85765-3-PBS capture and 85765-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9764

Product name: Recombinant human PRL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-227 aa of BC015850

Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Predict reactive species
Full Name prolactin
Calculated Molecular Weight 227 aa, 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC015850
Gene Symbol Prolactin/PRL
Gene ID (NCBI) 5617
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01236
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Prolactin is also named as PRL and belongs to the somatotropin/prolactin family. The proteins encoded by PRL are secreted into the cell surroundings. And they are abundantly expressed in pituitary gland, adenohypophysis, decidua and testis. Indeed, chemically, prolactin appears in a multiplicity of posttranslational forms ranging from size variants to chemical modifications such as phosphorylation or glycosylation. It is not only synthesized in the pituitary gland, as originally described, but also within the central nervous system, the immune system, the uterus and its associated tissues of conception, and even the mammary gland itself (PMID: 11015620). Prolactin acts primarily on the mammary gland by promoting lactation (PMID: 30546056). The major form of prolactin found in the pituitary gland is 23 kDa, variants of prolactin have been characterized in many mammals, including humans. Of the cleaved forms that have been characterized, 14 kDa, 16 kDa, and 22 kDa prolactin variants have been most widely studied (PMID: 7937959) (PMID: 8425495).

Loading...
||
New chat Able
正在加载,请稍候...