Prolactin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85765-3-RR (same clone as 85765-3-PBS)

  mouse pituitary gland tissue were subjected to SDS PAGE followed by western blot with 85765-3-RR (PRL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85765-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pituitary gland using 85765-3-RR (same clone as 85765-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pituitary gland tissue slide using 85765-3-RR (Prolactin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85765-3-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse pituitary gland using 85765-3-RR (same clone as 85765-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pituitary gland tissue using Prolactin antibody (85765-3-RR, Clone: 242898A8 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85765-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85765-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85765-3-RR against Human Prolactin were performed. The affinity constant is 0.122 nM.

Prolactin Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 85765-3-PBS

Clone No.242898A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

PRL

---

Product Information

85765-3-PBS targets Prolactin in WB, IHC, IF-P, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9764

  Product name: Recombinant human PRL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC015850

  Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

• Full Name: prolactin
• Calculated Molecular Weight: 227 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC015850
• Gene Symbol: Prolactin/PRL
• Gene ID (NCBI): 5617
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01236
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Prolactin is also named as PRL and belongs to the somatotropin/prolactin family. The proteins encoded by PRL are secreted into the cell surroundings. And they are abundantly expressed in pituitary gland, adenohypophysis, decidua and testis. Indeed, chemically, prolactin appears in a multiplicity of posttranslational forms ranging from size variants to chemical modifications such as phosphorylation or glycosylation. It is not only synthesized in the pituitary gland, as originally described, but also within the central nervous system, the immune system, the uterus and its associated tissues of conception, and even the mammary gland itself (PMID: 11015620). Prolactin acts primarily on the mammary gland by promoting lactation (PMID: 30546056). The major form of prolactin found in the pituitary gland is 23 kDa, variants of prolactin have been characterized in many mammals, including humans. Of the cleaved forms that have been characterized, 14 kDa, 16 kDa, and 22 kDa prolactin variants have been most widely studied (PMID: 7937959) (PMID: 8425495).