PRMT5 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 82750-3-RR (same clone as 82750-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82750-3-RR (PRMT5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82750-3-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 82750-3-RR (same clone as 82750-3-PBS)

  WB result of PRMT5 antibody (82750-3-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PRMT5 transfected HepG2 cells. This data was developed using the same antibody clone with 82750-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 82750-3-RR (same clone as 82750-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82750-3-RR (PRMT5 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82750-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 82750-3-RR (same clone as 82750-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82750-3-RR (PRMT5 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82750-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 82750-3-RR (same clone as 82750-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 82750-3-RR (PRMT5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82750-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 82750-3-RR (same clone as 82750-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 82750-3-RR (PRMT5 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82750-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82750-3-RR (same clone as 82750-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PRMT5 antibody (82750-3-RR, Clone: 250553F4 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82750-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82750-3-RR (same clone as 82750-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PRMT5 antibody (82750-3-RR, Clone: 250553F4 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82750-3-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02769-1

  The mean PRMT5 concentration was determined to be 35.0 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 27.2 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02769-1

  Cytometric bead array standard curve of MP02769-1, PRMT5 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 82750-4-PBS. Detection antibody: 82750-3-PBS. Standard: Ag9736. Range: 0.625-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 82750-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82750-3-RR against Human PRMT5 were performed. The affinity constant is 0.604 nM.

• Featured Product
• KD/KO Validated

PRMT5 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 82750-3-PBS

Clone No.250553F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

72 kDa ICln-binding protein, EC:2.1.1.320, Histone-arginine N-methyltransferase PRMT5, Jak-binding protein 1, Protein arginine N methyltransferase 5

---

Product Information

82750-3-PBS targets PRMT5 as part of a matched antibody pair:

MP02769-1: 82750-4-PBS capture and 82750-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9736

  Product name: Recombinant human PRMT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 283-637 aa of BC025979

  Sequence: YLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

• Full Name: protein arginine methyltransferase 5
• Calculated Molecular Weight: 637 aa, 73 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC025979
• Gene Symbol: PRMT5
• Gene ID (NCBI): 10419
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14744
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRMT5 is a Type II enzyme that catalyzes arginine monomethylation and symmetric dimethylation (Rme1 and Rme2s). The many targets of PRMT5 include ribosomal proteins, the histone chaperone nucleoplasmin, p53, and histones. PRMT5 is frequently observed in a complex with the cofactor, methylosome protein 50 (MEP50), which is required for PRMT5 activity. PRMT5 is upregulated in several human malignancies, including lymphomas, lung cancer, breast cancer and colorectal cancer.