• Featured Product
  • KD/KO Validated

PRMT5 Recombinant monoclonal antibody, PBS Only (Detector)

PRMT5 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 82750-3-PBS
Clone No.250553F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

72 kDa ICln-binding protein, EC:2.1.1.320, Histone-arginine N-methyltransferase PRMT5, Jak-binding protein 1, Protein arginine N methyltransferase 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82750-3-PBS targets PRMT5 as part of a matched antibody pair:

MP02769-1: 82750-4-PBS capture and 82750-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9736

Product name: Recombinant human PRMT5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 283-637 aa of BC025979

Sequence: YLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

Predict reactive species
Full Name protein arginine methyltransferase 5
Calculated Molecular Weight 637 aa, 73 kDa
Observed Molecular Weight67-70 kDa
GenBank Accession NumberBC025979
Gene Symbol PRMT5
Gene ID (NCBI) 10419
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14744
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PRMT5 is a Type II enzyme that catalyzes arginine monomethylation and symmetric dimethylation (Rme1 and Rme2s). The many targets of PRMT5 include ribosomal proteins, the histone chaperone nucleoplasmin, p53, and histones. PRMT5 is frequently observed in a complex with the cofactor, methylosome protein 50 (MEP50), which is required for PRMT5 activity. PRMT5 is upregulated in several human malignancies, including lymphomas, lung cancer, breast cancer and colorectal cancer.

Loading...
||
New chat

Able

正在加载,请稍候...