PRND Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRND Polyclonal antibody, PBS Only (26947-1-PBS)

• 

  WB analysis using 26947-1-AP (same clone as 26947-1-PBS)

  Non-treated mouse testis and glucosidase treated mouse testis tissue were subjected to SDS PAGE followed by western blot with 26947-1-AP (PRND antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26947-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26947-1-AP (same clone as 26947-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26947-1-AP (PRND antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26947-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 26947-1-AP (same clone as 26947-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26947-1-AP (PRND antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26947-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 26947-1-AP (same clone as 26947-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26947-1-AP (PRND antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26947-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 26947-1-AP (same clone as 26947-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PRND antibody (26947-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26947-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 26947-1-AP (same clone as 26947-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PRND antibody (26947-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26947-1-PBS in a different storage buffer formulation.

PRND Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 26947-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

26947-1-PBS targets PRND in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25523

  Product name: Recombinant human PRND protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-176 aa of BC043644

  Sequence: GIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLMVK

• Full Name: prion protein 2 (dublet)
• Calculated Molecular Weight: 176 aa, 20 kDa
• Observed Molecular Weight: 17-20, 30 kDa
• GenBank Accession Number: BC043644
• Gene Symbol: PRND
• Gene ID (NCBI): 23627
• RRID: AB_2880695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKY0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The prion gene family is mainly composed of three genes; PRNP, encoding the prion protein (PrP), PRND, encoding Doppel (Dpl), both located on the same genomic locus on mouse chromosome 2 and SPRN, encoding Shadoo (Sho), located on mouse chromosome 7. PRND (prion protein 2 also called Doppel) is a membranean N-glycosylated, glycosylphosphatidylinositol-anchored protein that is found predominantly in testis. PRND gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prionprotein, to which it is biochemically and structurally similar. 26947-1-AP antibody detects a 30 kDa glycosylated protein and a 17-20 kDa protein treated by glucosidase.