PRODH Monoclonal antibody, PBS Only

PRODH Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68621-1-PBS
Clone No.2C3G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, Indirect ELISA

2C3G5, EC:1.5.5.2, HSPOX2, p53-induced gene 6 protein, PIG6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68621-1-PBS targets PRODH in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18429

Product name: Recombinant human PRODH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 143-492 aa of BC118597

Sequence: LAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGIASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA

Predict reactive species
Full Name proline dehydrogenase (oxidase) 1
Calculated Molecular Weight 600 aa, 68 kDa
Observed Molecular Weight56 kDa, 66 kDa
GenBank Accession NumberBC118597
Gene Symbol PRODH
Gene ID (NCBI) 5625
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43272
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PRODH(Proline dehydrogenase 1, mitochondrial) is also named as PIG6, HSPOX2, PRODH1, PRODH2, POX, SCZD4, TP53I6 and belongs to the proline oxidase family. It is an oxidoreductase involved in the transfer of redox potential across the mitochondrial membrane and catalyzes the rate-limiting oxidation of proline to pyrroline- 5-carboxylate (P5C). High PRODH activity is sufficient to induce mitochondria-mediated apoptosis in the presence of proline. Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1) and defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4). This protein has 3 isoforms produced by alternative splicing with the molecular mass of 68 kDa, 59 kDa and 56 kDa.

Loading...
||
New chat Able
正在加载,请稍候...