Tested Applications
| Positive WB detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21367-1-AP targets PROKR1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15838 Product name: Recombinant human PROKR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC100960 Sequence: METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDE Predict reactive species |
| Full Name | prokineticin receptor 1 |
| Calculated Molecular Weight | 393 aa, 45 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC100960 |
| Gene Symbol | PROKR1 |
| Gene ID (NCBI) | 10887 |
| RRID | AB_3742031 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TCW9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PROKR1, also named as GPR73, PKR1 and PK-R1, belongs to the G-protein coupled receptor 1 family. It is a receptor for prokineticin 1. PROKR1 exclusively coupled to the G(q) subclass of heteromeric G proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PROKR1 antibody 21367-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

