PROSC Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83831-5-RR (same clone as 83831-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83831-5-RR (PROSC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83831-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 83831-5-RR (same clone as 83831-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 83831-5-RR (PROSC antibody) at dilution of 1:650 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83831-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83831-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83831-5-RR against Human PROSC were performed. The affinity constant is 2.00 nM.

PROSC Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83831-5-PBS

Clone No.240998B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

PLPBP, 240998B6, PLP homeostasis protein, Proline synthase co-transcribed bacterial homolog protein, Pyridoxal phosphate homeostasis protein

---

Product Information

83831-5-PBS targets PROSC in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18369

  Product name: Recombinant human PROSC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC012334

  Sequence: MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH

• Full Name: proline synthetase co-transcribed homolog (bacterial)
• Calculated Molecular Weight: 275 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012334
• Gene Symbol: PROSC
• Gene ID (NCBI): 11212
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O94903
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human Pyridoxal 5′-phosphate-binding protein (PLPBP; previously proline synthase cotranscribed homolog, PROSC) was first described in 1999 and was demonstrated to be ubiquitously expressed in many tissues. PROSC is ubiquitously expressed in human tissues and is highly conserved throughout evolution. PROSC deficiency could therefore markedly increase free cellular PLP levels (PMID: 31825581, 27912044).