PROX1 Polyclonal antibody

• 

  WB analysis of human brain using 51043-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 51043-1-AP (PROX1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 51043-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 51043-1-AP (PROX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 51043-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 51043-1-AP (PROX1 antibody) at dilution of 1:50 (under 10x lens).

• Featured Product
• KD/KO Validated

PROX1 Polyclonal Antibody for ELISA

Cat No. 51043-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, CoIP, ChIP, ELISA

Synonyms

prospero homeobox 1, Prospero homeobox protein 1, PROX 1, PROX1

---

Published Applications

• KD/KO: See 3 publications below
• WB: See 6 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• IP: See 1 publications below
• CoIP: See 3 publications below
• ChIP: See 2 publications below

Product Information

51043-1-AP targets PROX1 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0457

  Product name: Recombinant human PROX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 546-736 aa of BC024201

  Sequence: TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH

• Full Name: prospero homeobox 1
• Calculated Molecular Weight: 737 aa, 83 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC024201
• Gene Symbol: PROX1
• Gene ID (NCBI): 5629
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92786
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PROX1, Prospero homeobox protein 1, belongs to the Prospero homeobox family and contain a Prospero-type homeobox DNA-binding domain. PROX1 plays a fundamental role in early development of CNS and regulated the expression of gene and development of postmitotic undifferentiated young neuron. Also PROX1 is a specific and required regulator of the development of the lymphatic system. This is a rabbit polyclonal antibody raised against part of C-terminal chain of human PROX1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,CoIP,ChIP	Genes Dev; The homeobox protein Prox1 is a negative modulator of ERR{alpha}/PGC-1{alpha} bioenergetic functions.; Authors - Charest-Marcotte Alexis A ; KD Validated
mouse	CoIP,chIP	Nat Commun; An HDAC3-PROX1 corepressor module acts on HNF4α to control hepatic triglycerides.; Authors - Sean M Armour
human	WB	PLoS Genet; Genomic convergence among ERRα, PROX1, and BMAL1 in the control of metabolic clock outputs.; Authors - Dufour Catherine R CR ; KD Validated
human	WB	Nucleic Acids Res; Prospero-related homeobox 1 (Prox1) functions as a novel modulator of retinoic acid-related orphan receptors α- and γ-mediated transactivation.; Authors - Takeda Yukimasa Y ; KD Validated
human	IHC,IF	Am J Pathol; Lymphotoxins Promote the Progression of Human Lymphatic Malformation by Enhancing Lymphatic Endothelial Cell Proliferation.; Authors - Jie-Gang Yang
human	IHC	PLoS One; Impact of an Altered PROX1 Expression on Clinicopathology, Prognosis and Progression in Renal Cell Carcinoma.; Authors - Tao Lv