Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PROX1 Polyclonal antibody

PROX1 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11067-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (4)

Applications

WB, IF/ICC, FC (Intra), IP, ChIP, ELISA

Homeobox prospero-like protein PROX1, prospero homeobox 1, Prospero homeobox protein 1, PROX-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, human liver tissue, MCF-7 cells, HuH-7 cells, SH-SY5Y cells
Positive IP detected inHepG2 cells
Positive IF/ICC detected inHuH-7 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11067-2-AP targets PROX1 in WB, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1543

Product name: Recombinant human PROX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 546-736 aa of BC024201

Sequence: TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH

Predict reactive species
Full Name prospero homeobox 1
Calculated Molecular Weight 737 aa, 83 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC024201
Gene Symbol PROX1
Gene ID (NCBI) 5629
RRIDAB_2268804
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92786
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prospero-related homeobox 1 (Prox1) is a homeobox transcription factor involved in various developmental processes, including neurogenesis and lymphangiogenesis. In the central nervous system (CNS), it controls the maintenance, proliferation, and differentiation of neural stem cells. This is a rabbit polyclonal antibody raised against part of C-terminal chain of human PROX1. The calcualted molecular weight of PROX1 is 83 kDa.

 

What is the molecular weight of KEAP1 protein? Is Prox1 post-translationally modified?

The calculated molecular weight of Prox1 protein is 83 kDa but the observed weight is 95 kDa. Prox1 is a subject of SUMO-ylation at K556, which is important for its transcription activity and increases the molecular weight of Prox1 to 110 kDa (PMID: 19706680). Usually there is a pool of modified and unmodified Prox1 protein in cells and therefore it is quite common to observe two specific bands in western blotting using Prox1 antibody.

 

What is the subcellular localization of Prox1?

Prox1 contains a nuclear localization signal within its N-terminus and resides in the nucleus, where it acts as a transcription factor.

 

What is the tissue expression pattern of Prox1 in the central nervous system?

Prox1 expression in the central nervous system (CNS) depends on the developmental stage. During embryogenesis Prox1 is present in neuronal precursors located in the subventricular zone, while during fetal development it is additionally present in the cerebral and cerebellar cortex and hippocampus. Postnatally, Prox1 expression in the CNS is restricted to the dentate gyrus of the hippocampus and cerebellum (PMID: 17117441). Therefore, Prox1 can be used as a marker of a subset of neuronal progenitors, as well as a specific marker of dentate gyrus cell lineage, such as type-2 intermediate progenitors and mature granule cells.

 

Is Prox1 expressed outside of the central nervous system?

Yes. Prox1 is expressed in the developmental stages of the eye lens, liver, pancreas, heart, and the lymphatic system (PMID: 22733308). Prox1 is also expressed post-developmentally in lymphatic endothelial cells and is often used, together with VEGFR-3, as a marker for lymphatic vessels.

Protocols

Product Specific Protocols
FC protocol for PROX1 antibody 11067-2-APDownload protocol
IF protocol for PROX1 antibody 11067-2-APDownload protocol
IP protocol for PROX1 antibody 11067-2-APDownload protocol
WB protocol for PROX1 antibody 11067-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nature

Meningeal lymphatic vessels at the skull base drain cerebrospinal fluid.

Authors - Ji Hoon Ahn
mousechIP

Nature

The role of fatty acid β-oxidation in lymphangiogenesis.

Authors - Brian W Wong
human,mouseIF

Nat Immunol

Sparcl1 mitigates abdominal aortic aneurysm through inhibiting lymphangiogenesis-mediated TLS formation

Authors - Mei-Hua Chen
humanWB,IF

Cell Metab

Neurotensin is an anti-thermogenic peptide produced by lymphatic endothelial cells.

Authors - Jin Li
humanWB,IF

Hepatology

Prospero-related homeobox 1 drives angiogenesis of hepatocellular carcinoma through selectively activating interleukin-8 expression.

Authors - Yanfeng Liu
  • KD Validated
mouseWB,IF,ChIP

Genes Dev

The Prox1-Vegfr3 feedback loop maintains the identity and the number of lymphatic endothelial cell progenitors.

Authors - R Sathish Srinivasan
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Guang (Verified Customer) (11-12-2018)

We use heat antigen retrieval , but we didn't get any result by using this antibody. If it is possible, you can send me another free sample of this type. I will test it by using the enzymatic antigen retrieval or EDTA method to perform the Immunofluorescence.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: mouse embryo
Loading...
||
New chat

Able

正在加载,请稍候...