Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, L02 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
10261-1-AP targets PRPF18 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0329 Product name: Recombinant human PRPF18 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-47 aa of BC002572 Sequence: MDILKSEILRKRQLVEDRNLLREYVKANDAYLQMAIGNAPWPIGVTM Predict reactive species |
| Full Name | PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 5 aa, 475 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC002572 |
| Gene Symbol | PRPF18 |
| Gene ID (NCBI) | 8559 |
| RRID | AB_3741814 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99633 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRPF18 encodes a spliceosomal factor that is essential for the catalytic step II of pre-mRNA splicing. It functions in the spliceosome during RNA processing and shows sequence similarity to the yeast splicing factor Prp18. The protein contains WD repeats, a feature consistent with protein-protein interactions, and belongs to the PRP18 family and the spliceosomal C complex.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PRPF18 antibody 10261-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

