PRPF18 Polyclonal antibody

• 

  WB analysis using 10261-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10261-1-AP (PRPF18 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

PRPF18 Polyclonal Antibody for WB, ELISA

Cat No. 10261-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

hPRP18, Pre-mRNA-splicing factor 18, PRP18, PRPF 18

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10261-1-AP targets PRPF18 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0329

  Product name: Recombinant human PRPF18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-47 aa of BC002572

  Sequence: MDILKSEILRKRQLVEDRNLLREYVKANDAYLQMAIGNAPWPIGVTM

• Full Name: PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae)
• Calculated Molecular Weight: 5 aa, 475 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC002572
• Gene Symbol: PRPF18
• Gene ID (NCBI): 8559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99633
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.