PRPF4 Polyclonal antibody

• 

  WB analysis using 10728-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10728-1-AP (PRPF4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10728-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10728-1-AP (PRPF4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10728-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10728-1-AP (PRPF4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 10728-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10728-1-AP (PRPF4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10728-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10728-1-AP (PRPF4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 10728-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 10728-1-AP (PRPF4 antibody) at dilution of 1:10 (under 10x lens).

PRPF4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10728-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

HPRP4, HPRP4P, PRP4, PRP4 homolog, Prp4p, PRPF4, U4/U6 snRNP 60 kDa protein, WD splicing factor Prp4

---

Tested Applications

• Positive WB detected in: HeLa cells, Raji cells, HEK-293 cells, HepG2 cells, K-562 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

10728-1-AP targets PRPF4 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1193

  Product name: Recombinant human PRPF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 213-522 aa of BC001588

  Sequence: ELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

• Full Name: PRP4 pre-mRNA processing factor 4 homolog (yeast)
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC001588
• Gene Symbol: PRPF4
• Gene ID (NCBI): 9128
• RRID: AB_2171027
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43172
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRPF4, also named as U4/U6 small nuclear ribonucleoprotein Prp4, is a 522 amino acid protein, which contains seven WD repeats. PRPF4 localizes in the Nucleus speckle. PRPF4 participates in pre-mRNA splicing and is a part of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome.PRPF4-mediated phosphorylation of KLF13 plays a role in the regulation of CCL5 expression in T lymphocytes

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; MEN1 is a regulator of alternative splicing and prevents R-loop-induced genome instability through suppression of RNA polymerase II elongation; Authors - Bangming Jin
human	WB	Hum Mol Genet; PRPF mutations are associated with generalized defects in spliceosome formation and pre-mRNA splicing in patients with retinitis pigmentosa.; Authors - Tanackovic Goranka G
mouse	WB	J Biol Chem; Intercellular transfer of proteins as identified by stable isotope labeling of amino acids in cell culture.; Authors - Li Ming M
human	WB	Cell Rep Med; Clinical-proteomic classification and precision treatment strategy of chordoma; Authors - Huabin Yin