PRPF4B Polyclonal antibody

• 

PRPF4B Polyclonal Antibody for ELISA

Cat No. 16987-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

KIAA0536, PR4H, PRP4, PRP4 kinase, PRP4H, PRP4K, PRPF4B

---

Product Information

16987-1-AP targets PRPF4B in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10587

  Product name: Recombinant human PRPF4B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 668-1007 aa of BC034969

  Sequence: WTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLLRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADNDITPYLFSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQEKI

• Full Name: PRP4 pre-mRNA processing factor 4 homolog B (yeast)
• Calculated Molecular Weight: 1007 aa, 117 kDa
• GenBank Accession Number: BC034969
• Gene Symbol: PRPF4B
• Gene ID (NCBI): 8899
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13523
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.