PRR13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRR13 Polyclonal antibody, PBS Only (14101-1-PBS)

• 

  WB analysis using 14101-1-AP (same clone as 14101-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14101-1-AP (PRR13 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14101-1-PBS in a different storage buffer formulation.

PRR13 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14101-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

14101-1-PBS targets PRR13 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5280

  Product name: Recombinant human PRR13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC066943

  Sequence: MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQLLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSSSSSSSDSD

• Full Name: proline rich 13
• Calculated Molecular Weight: 15.2 kDa
• Observed Molecular Weight: ~20 kDa
• GenBank Accession Number: BC066943
• Gene Symbol: PRR13
• Gene ID (NCBI): 54458
• RRID: AB_2878012
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ81
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRR13, also named as TXR1, is reported to be a key regulator of the resistance to cytostatica by decreasing the copy number of the proapoptotic gene thrombospondin-1. PRR13 has some isoforms with MW 10 kDa, 15-17 kDa and 19-23 kDa.