PRR4 Polyclonal antibody

• 

PRR4 Polyclonal Antibody for ELISA

Cat No. 11909-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

Lacrimal proline rich protein, LPRP, PROL4, proline rich 4 (lacrimal), Proline rich protein 4, PRR4

---

Product Information

11909-1-AP targets PRR4 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2589

  Product name: Recombinant human PRR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC058035

  Sequence: MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEASSFFRRDRPARHPQEQPLW

• Full Name: proline rich 4 (lacrimal)
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC058035
• Gene Symbol: PRR4
• Gene ID (NCBI): 11272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16378
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.