Product Information
29790-1-PBS targets Trypsin 1/PRSS1 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31383 Product name: Recombinant human PRSS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-140 aa of BC128226 Sequence: IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCL Predict reactive species |
| Full Name | protease, serine, 1 (trypsin 1) |
| Calculated Molecular Weight | 27 kDa |
| GenBank Accession Number | BC128226 |
| Gene Symbol | PRSS1 |
| Gene ID (NCBI) | 5644 |
| RRID | AB_3669696 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07477 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PRSS1 encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.
