PRSS8 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PRSS8 Monoclonal antibody (60912-3-Ig)

PRSS8 Monoclonal Antibody for WB, ELISA

Cat No. 60912-3-Ig

Clone No.1H3C12

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, ELISA

Synonyms

CAP1, Channel-activating protease 1, EC:3.4.21.-, Prostasin heavy chain, Prostasin light chain

• 

  WB analysis using 60912-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60912-3-Ig (PRSS8 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: SK-BR-3 cells, Calu-3 cells, LNCaP cells, BT-474 cells, HT-1376 cells, Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60912-3-Ig targets PRSS8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7234

  Product name: Recombinant human PRSS8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-325 aa of BC001462

  Sequence: SGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPIL

• Full Name: protease, serine, 8
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC001462
• Gene Symbol: PRSS8
• Gene ID (NCBI): 5652
• RRID: AB_3743241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16651
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protease serine S1 family member 8 (PRSS8), a membrane-anchored serine protease, has been reported to be involved in the development of several human cancers. PRSS8 protein level was highly expressed in well differentiated cancer cell and was lower or absent in poorly differentiated cancer cell. Significantly higher levels of prostasin were found in early stage OVC serum samples compared to benign ovarian and normal donor samples. Overexpression of PRSS8 mRNA and high levels of prostasin in multiple subtypes of early stage ovarian tumors may provide clinical biomarkers for early detection of OVC. (PMID: 27036110, PMID: 27050145)