PRTFDC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PRTFDC1 Polyclonal antibody (11986-1-AP)

PRTFDC1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11986-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

HHGP, Phosphoribosyltransferase domain-containing protein 1

• 

  WB analysis of fetal human brain using 11986-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 11986-1-AP (PRTFDC1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 11986-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11986-1-AP (PRTFDC1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 11986-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 11986-1-AP (PRTFDC1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 11986-1-AP

  IP result of anti-PRTFDC1 (IP:11986-1-AP, 4ug; Detection:11986-1-AP 1:600) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 11986-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 11986-1-AP (PRTFDC1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SKOV-3 using 11986-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SKOV-3 cells using PRTFDC1 antibody (11986-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, human brain tissue, Y79 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SKOV-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11986-1-AP targets PRTFDC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2614

  Product name: Recombinant human PRTFDC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC008662

  Sequence: MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV

• Full Name: phosphoribosyl transferase domain containing 1
• Calculated Molecular Weight: 225 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC008662
• Gene Symbol: PRTFDC1
• Gene ID (NCBI): 56952
• RRID: AB_2284509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRG1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRTFDC1 (phosphoribosyl transferase domain containing 1) is a homolog of the enzyme hypoxanthine-guanine phosphoribosyltransferase (HPRT) but has very low catalytic activity due to a critical amino acid substitution in its active site. Functionally, PRTFDC1 is suggested to act as a tumor suppressor ; its epigenetic silencing by promoter hypermethylation has been observed in oral squamous cell carcinomas, and its restoration can inhibit cell growth.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	PLoS One; PRTFDC1 is a genetic modifier of HPRT-deficiency in the mouse.; Authors - Keebaugh Alaine C AC
	IHC	Mol Ther Oncol; Phosphoribosyl transferase domain containing 1: A prognostic biomarker in testicular germ cell tumors; Authors - Peisheng Huang