PR3/PRTN3 Polyclonal antibody

• 

  WB analysis of human placenta using 25278-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 25278-1-AP (PRTN3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 25278-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 25278-1-AP (PRTN3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 25278-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 25278-1-AP (PRTN3 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 25278-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 25278-1-AP (PRTN3 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 25278-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25278-1-AP (PRTN3 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 25278-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25278-1-AP (PRTN3 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 25278-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25278-1-AP (PRTN3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon cancer using 25278-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25278-1-AP (PRTN3 Antibody) at dilution of 1:200 (under 40x lens).

PR3/PRTN3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25278-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

PRTN3, PR3, NP-4, Myeloblastin, MBN

---

Tested Applications

• Positive WB detected in: human placenta tissue
• Positive IHC detected in: human tonsillitis tissue, human colon cancer tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

25278-1-AP targets PR3/PRTN3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16765

  Product name: Recombinant human PRTN3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-256 aa of BC096183

  Sequence: RAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP

• Full Name: proteinase 3
• Calculated Molecular Weight: 256 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC096183
• Gene Symbol: PRTN3
• Gene ID (NCBI): 5657
• RRID: AB_2880003
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24158
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Biomedicines; Comparative Proteomic Analysis of tPVAT during Ang II Infusion.; Authors - Xiuying Liang
human	WB	Front Cell Neurosci; Meningitic Escherichia coli-Induced Interleukin-17A Facilitates Blood-Brain Barrier Disruption via Inhibiting Proteinase 3/Protease-Activated Receptor 2 Axis.; Authors - Bojie Xu
human	WB	Toxicol In Vitro; Activation of inflammasomes by tyrosine kinase inhibitors of vascular endothelial growth factor receptor: Implications for VEGFR TKIs-induced immune related adverse events.; Authors - Hideki Imano

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Malgorzata (Verified Customer) (08-08-2022)

The antibody worked on my positive control - cell lysate from cultured THP-1 cells

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: THP-1

PR3/PRTN3 Antibody Western Blot validation (1000 dilution) in THP-1 (Cat no:25278-1-AP)