PSAP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PSAP Polyclonal antibody (18397-1-AP)

• Featured Product
• KD/KO Validated

PSAP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18397-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

A1 activator, Cerebroside sulfate activator, Co beta glucosidase, Component C, CSAct

• 

  WB analysis using 18397-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 18397-1-AP

  WB result of PSAP antibody (18397-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAP transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 18397-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 18397-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 18397-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 18397-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 18397-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18397-1-AP (PSAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18397-1-AP (PSAP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18397-1-AP (PSAP Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18397-1-AP (PSAP Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18397-1-AP (PSAP antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18397-1-AP (PSAP antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 18397-1-AP (PSAP antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 18397-1-AP (PSAP antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 18397-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using PSAP antibody (18397-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PSAP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, PC-3 cells, HepG2 cells, L02 cells, MCF-7 cells
• Positive IHC detected in: human prostate cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18397-1-AP targets PSAP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13264

  Product name: Recombinant human PSAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-274 aa of BC001503

  Sequence: DVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEV

• Full Name: prosaposin
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC001503
• Gene Symbol: PSAP
• Gene ID (NCBI): 5660
• RRID: AB_10598628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07602
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin B.

Publications

What published studies show

The PSAP Polyclonal antibody (Cat# 18397-1-AP) has 1 citation. It was cited in Journal of Neurochemistry in a study investigating prosaposin cleavage into saposins by cathepsins under progranulin regulation. The research field encompasses neurochemistry, lysosomal biology, and proteolytic processing. The application used was Western blot (WB) in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Neurochem; Prosaposin Is Cleaved Into Saposins by Multiple Cathepsins in a Progranulin-Regulated Fashion.; Authors - Molly Hodul