PSAP Polyclonal antibody

• 

  WB analysis using 18397-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18397-1-AP

  WB result of PSAP antibody (18397-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAP transfected HepG2 cells.

• 

  WB analysis of PC-3 using 18397-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 18397-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18397-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 18397-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 18397-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 18397-1-AP (PSAP antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18397-1-AP (PSAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18397-1-AP (PSAP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18397-1-AP (PSAP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18397-1-AP (PSAP Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18397-1-AP (PSAP antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18397-1-AP (PSAP antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 18397-1-AP (PSAP antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 18397-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 18397-1-AP (PSAP antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of A431 using 18397-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using PSAP antibody (18397-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

PSAP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18397-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

A1 activator, Cerebroside sulfate activator, Co beta glucosidase, Component C, CSAct

---

Tested Applications

• Positive WB detected in: HEK-293 cells, PC-3 cells, HepG2 cells, L02 cells, MCF-7 cells
• Positive IHC detected in: human prostate cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18397-1-AP targets PSAP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13264

  Product name: Recombinant human PSAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-274 aa of BC001503

  Sequence: DVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEV

• Full Name: prosaposin
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC001503
• Gene Symbol: PSAP
• Gene ID (NCBI): 5660
• RRID: AB_10598628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07602
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin B.