PSAP Polyclonal antibody

• 

  WB analysis using 18423-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18423-1-AP (PSAP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18423-1-AP

  WB result of PSAP antibody (18423-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAP transfected HepG2 cells.

• 

  WB analysis of HeLa using 18423-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18423-1-AP (PSAP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18423-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18423-1-AP (PSAP Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 18423-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18423-1-AP (PSAP antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 18423-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18423-1-AP (PSAP antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver cancer using 18423-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18423-1-AP (PSAP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 18423-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18423-1-AP (PSAP Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 18423-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18423-1-AP (PSAP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 18423-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18423-1-AP (PSAP Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

PSAP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18423-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

A1 activator, Cerebroside sulfate activator, Co beta glucosidase, Component C, CSAct, Dispersin, GLBA, Glucosylceramidase activator, Proactivator polypeptide, prosaposin, Protein C, PSAP, SAP 1, SAP 2 Saposin D, SAP1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human liver cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18423-1-AP targets PSAP in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13266

  Product name: Recombinant human PSAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 406-487 aa of BC001503

  Sequence: GGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHK

• Full Name: prosaposin
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC001503
• Gene Symbol: PSAP
• Gene ID (NCBI): 5660
• RRID: AB_10643525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07602
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin D.