PSENEN Polyclonal antibody

• 

  WB analysis using 16144-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16144-1-AP (PSENEN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 16144-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16144-1-AP (PSENEN Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 16144-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16144-1-AP (PSENEN Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PSENEN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16144-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Gamma secretase subunit PEN 2, Gamma-secretase subunit PEN-2, PEN 2, PEN2, Presenilin enhancer protein 2

---

Tested Applications

• Positive WB detected in: A549 cells, Neuro-2a cells, mouse lung tissue, rat spleen tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16144-1-AP targets PSENEN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9243

  Product name: Recombinant human PSENEN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC009575

  Sequence: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP

• Full Name: presenilin enhancer 2 homolog (C. elegans)
• Calculated Molecular Weight: 101 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC009575
• Gene Symbol: PSENEN
• Gene ID (NCBI): 55851
• RRID: AB_3669231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ42
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSENEN, also named PEN2, is a component of the gamma-secretase complex, which also includes presenilin (PSEN1) and nicastrin (NCSTN). The gamma-secretase complex is required for the intramembrane proteolysis of a number of membrane proteins, including the amyloid-beta precursor protein (APP) and Notch. PSENEN is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2).