PSG6 Polyclonal antibody

• 

PSG6 Polyclonal Antibody for ELISA

Cat No. 16350-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

CGM3, PS beta G 10, PS beta G 12, PS beta G 6, PSBG 10, PSBG 12, PSBG 6, PSG10, PSG12, PSG6, PSGGB

---

Product Information

16350-1-AP targets PSG6 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9555

  Product name: Recombinant human PSG6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-424 aa of BC020652

  Sequence: MTDLYHYITSYVVHGQIIYGPAYSGRETVYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSISSSNLNPREVMEAVRLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPMPYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLDLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSGPCHGNQTESH

• Full Name: pregnancy specific beta-1-glycoprotein 6
• Calculated Molecular Weight: 424 aa, 48 kDa
• GenBank Accession Number: BC020652
• Gene Symbol: PSG6
• Gene ID (NCBI): 5675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00889
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.