PSIP1 Polyclonal antibody

• 

  WB analysis using 29434-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29434-1-AP (PSIP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29434-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29434-1-AP (PSIP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 29434-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PSIP1 antibody (29434-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

PSIP1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 29434-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

CLL associated antigen KW 7, DFS 70, DFS70, LEDGF, p52, p75, PAIP, PSIP1, PSIP2

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, Jurkat cells, NIH/3T3 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29434-1-AP targets PSIP1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30640

  Product name: Recombinant human PSIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 104-325 aa of NM_021144

  Sequence: ASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETE

• Full Name: PC4 and SFRS1 interacting protein 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_021144
• Gene Symbol: PSIP1
• Gene ID (NCBI): 11168
• RRID: AB_3086132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75475
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSIP1 enables DNA-binding transcription factor binding activity, chromatin binding activity and transcription coactivator activity. It is involved in mRNA 5'-splice site recognition and positive regulation of transcription by RNA polymerase II.