PSMA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PSMA3 Polyclonal antibody (11887-1-AP)

PSMA3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11887-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PSC8, Proteasome subunit alpha type-3, HC8

• 

  WB analysis of A549 using 11887-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11887-1-AP (PSMA3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human lung using 11887-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11887-1-AP (PSMA3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-12 using 11887-1-AP

  PC-12 cells were subjected to SDS PAGE followed by western blot with 11887-1-AP (PSMA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11887-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11887-1-AP (PSMA3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 11887-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11887-1-AP (PSMA3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 11887-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11887-1-AP (PSMA3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 11887-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11887-1-AP (PSMA3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 11887-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11887-1-AP (PSMA3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11887-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11887-1-AP (PSMA3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11887-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PSMA3 antibody (11887-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PSMA3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, PC-12 cells, human lung tissue, COS-7 cells, RAW 264.7 cells, mouse spleen tissue, rat brain tissue, HeLa cells, NIH/3T3 cells, mouse liver tissue
• Positive IHC detected in: human lymphoma tissue, human liver cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11887-1-AP targets PSMA3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2495

  Product name: Recombinant human PSMA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-255 aa of BC029402

  Sequence: MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADMAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

• Full Name: proteasome (prosome, macropain) subunit, alpha type, 3
• Calculated Molecular Weight: 255 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC029402
• Gene Symbol: PSMA3
• Gene ID (NCBI): 5684
• RRID: AB_2171420
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25788
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMA3(Proteasome subunit alpha type-3) is also named as HC8, PSC8 and belongs to the peptidase T1A family. The proteasome is a multicatalytic protease complex that catalyzes an energy-dependent, extralysosomal proteolytic pathway responsible for selective elimination of proteins with aberrant structures and naturally occurring short-lived proteins related to metabolic regulation and cell cycle progression. It has 2 isoforms produced by alternative splicing.

Publications

What published studies show

The PSMA3 Polyclonal antibody (Cat# 11887-1-AP) has 10 total citations. These appear in journals including Nature Neuroscience, Nature Cardiovascular Research, Research, Free Radical Biology and Medicine, Clinical and Translational Medicine, JCI Insight, Cell and Molecular Life Sciences, iScience, and ChemMedChem. The associated research fields span proteasome biology and function, tau protein degradation, oxidative modification, stress granule clearance, meiosis, cardiovascular function, renal ischemia-reperfusion, ovarian cancer, and neuroprotection against β-amyloid toxicity.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Neurosci; Neuroproteasomes regulate endogenous tau paired helical filament formation in an APOE genotype- and age-dependent manner.; Authors - Victoria Paradise
		Nat Neurosci; Dendritic translation and neuroproteasome-mediated degradation of endogenous tau revealed by STARFISH.; Authors - Kalin D. Konrad-Vicario
human	WB	Research (Wash D C); SERBP1 Promotes Stress Granule Clearance by Regulating 26S Proteasome Activity and G3BP1 Ubiquitination and Protects Male Germ Cells from Thermostimuli Damage; Authors - Fengli Wang
		Nat Cardiovasc Res; p22(phox) prevents the oxidation of SERCA2a and stabilizes it in the heart.; Authors - Yasuki Nakada
human	ELISA	Free Radic Biol Med; Identification of an unstable 4-hydroxynoneal modification on the 20S proteasome subunit α7 by recombinant antibody technology.; Authors - Jesper Just
mouse	IF	Clin Transl Med; FBXW24 controls female meiotic prophase progression by regulating SYCP3 ubiquitination.; Authors - Yang Wang