PSMA3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67938-1-Ig (same clone as 67938-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67938-1-Ig (PSMA3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67938-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67938-1-Ig (same clone as 67938-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67938-1-Ig (PSMA3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67938-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67938-1-Ig (same clone as 67938-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67938-1-Ig (PSMA3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67938-1-PBS in a different storage buffer formulation.

PSMA3 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67938-1-PBS

Clone No.1A8C9

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HC8, Macropain subunit C8, Proteasome component C8, PSC3, PSC8, PSMA3

---

Product Information

67938-1-PBS targets PSMA3 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30552

  Product name: Recombinant human PSMA3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-255 aa of BC029402

  Sequence: MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADMAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

• Full Name: proteasome (prosome, macropain) subunit, alpha type, 3
• Calculated Molecular Weight: 255 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC029402
• Gene Symbol: PSMA3
• Gene ID (NCBI): 5684
• RRID: AB_2918690
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P25788
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMA3(Proteasome subunit alpha type-3) is also named as HC8, PSC8 and belongs to the peptidase T1A family. The proteasome is a multicatalytic protease complex that catalyzes an energy-dependent, extralysosomal proteolytic pathway responsible for selective elimination of proteins with aberrant structures and naturally occurring short-lived proteins related to metabolic regulation and cell cycle progression. It has 2 isoforms produced by alternative splicing.