PSMB2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68180-1-Ig (same clone as 68180-1-PBS)

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 68180-1-Ig (PSMB2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68180-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68180-1-Ig (same clone as 68180-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68180-1-Ig (PSMB2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68180-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68180-1-Ig (same clone as 68180-1-PBS)

  WB result of PSMB2 antibody (68180-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSMB2 transfected HeLa cells. This data was developed using the same antibody clone with 68180-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 68180-1-Ig (same clone as 68180-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68180-1-Ig (PSMB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68180-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HCT 116 using 68180-1-Ig (same clone as 68180-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HCT 116 cells using PSMB2 antibody (68180-1-Ig, Clone: 3C5C5 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68180-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68180-1-Ig (same clone as 68180-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PSMB2 antibody (68180-1-Ig, Clone: 3C5C5 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68180-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 68180-1-Ig (same clone as 68180-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using PSMB2 antibody (68180-1-Ig, Clone: 3C5C5 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68180-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PSMB2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68180-1-PBS

Clone No.3C5C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

3C5C5, Macropain subunit C7-I, Multicatalytic endopeptidase complex subunit C7-I, Proteasome component C7-I, Proteasome subunit beta type-2

---

Product Information

68180-1-PBS targets PSMB2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7308

  Product name: Recombinant human PSMB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC000268

  Sequence: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

• Full Name: proteasome (prosome, macropain) subunit, beta type, 2
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC000268
• Gene Symbol: PSMB2
• Gene ID (NCBI): 5690
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49721
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMB2(proteasome subunit beta type-2) is also named as macropain subunit C7-I, proteasome component C7-I, multicatalytic endopeptidase complex subunit C7-I and belongs to the peptidase T1B family. It is involved in an ATP/ubiquitin-dependent non-lysosomal proteolytic pathway. The up-regulation of PSMB2 may indicate the activated neuronal defensive mechanism in VAD(vitamin A depletion) brain regions, which may underlie the VAD-related psychosis behavior(PMID:21190828).