PSMB7 Polyclonal antibody

PSMB7 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 30283-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Macropain chain Z, Proteasome subunit beta type 7, Proteasome subunit Z, PSMB7, Z

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, MCF-7 cells, HepG2 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, mouse kidney tissue, rat kidney tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30283-1-AP targets PSMB7 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32201

Product name: Recombinant human PSMB7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 91-277 aa of BC000509

Sequence: TAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 7
Calculated Molecular Weight29.9 kDa
Observed Molecular Weight28-30 kDa
GenBank Accession NumberBC000509
Gene Symbol PSMB7
Gene ID (NCBI) 5695
RRIDAB_3086285
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99436
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. PSMB7 protein is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. Expression of this catalytic subunit is downregulated by gamma interferon, and proteolytic processing is required to generate a mature subunit. Component of the 20S core proteasome complex are involved in the proteolytic degradation of most intracellular proteins. PSMB7 displays a trypsin-like activity.(PMID:15244466, PMID:27176742, PMID: 8610016)

Protocols

Product Specific Protocols
WB protocol for PSMB7 antibody 30283-1-APDownload protocol
IHC protocol for PSMB7 antibody 30283-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...