PSMB9 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PSMB9 Recombinant monoclonal antibody, PBS Only (87013-2-PBS)

PSMB9 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87013-2-PBS

Clone No.252148A1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

LMP2, EC:3.4.25.1, Proteasome subunit beta type-9, Proteasome subunit beta-1i, PSMB6i

• 

  WB analysis using 87013-2-RR (same clone as 87013-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87013-2-RR (PSMB9 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87013-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 87013-2-RR (same clone as 87013-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PSMB9 antibody (87013-2-RR, Clone: 252148A1 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87013-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87013-2-PBS targets PSMB9 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6048

  Product name: Recombinant human PSMB9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-219 aa of BC065513

  Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

• Full Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC065513
• Gene Symbol: PSMB9
• Gene ID (NCBI): 5698
• RRID: AB_3745274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28065
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC.