PSMC3 Recombinant monoclonal antibody

• 

  WB analysis using 87128-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87128-4-RR (PSMC3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 87128-4-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PSMC3 antibody (87128-4-RR, Clone: 252375C1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity of 87128-4-RR

  Biolayer interferometry (BLl) kinetic assays of 87128-4-RR against Human PSMC3 were performed. The affinity constant is below 1 pM.

PSMC3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87128-4-RR

Clone No.252375C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

26S proteasome AAA-ATPase subunit RPT5, 26S proteasome regulatory subunit 6A, Tat-binding protein 1, TBP1, TBP-1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells, T-47D cells, U2OS cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87128-4-RR targets PSMC3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21408

  Product name: Recombinant human PSMC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-200 aa of BC008713

  Sequence: MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVE

• Full Name: proteasome (prosome, macropain) 26S subunit, ATPase, 3
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC008713
• Gene Symbol: PSMC3
• Gene ID (NCBI): 5702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17980
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.