PSMC3IP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84934-1-RR (same clone as 84934-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84934-1-RR (PSMC3IP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84934-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 84934-1-RR (same clone as 84934-1-PBS)

  Mouse testis tissue was subjected to SDS PAGE followed by western blot with 84934-1-RR (PSMC3IP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84934-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 84934-1-RR (same clone as 84934-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 84934-1-RR (PSMC3IP antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84934-1-PBS in a different storage buffer formulation.

PSMC3IP Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84934-1-PBS

Clone No.242517C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

242517C12, GT198, Homologous-pairing protein 2 homolog, HOP2, Proteasome 26S ATPase subunit 3-interacting protein

---

Product Information

84934-1-PBS targets PSMC3IP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1883

  Product name: Recombinant human PSMC3IP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC008792

  Sequence: MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP

• Full Name: PSMC3 interacting protein
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 24-29 kDa
• GenBank Accession Number: BC008792
• Gene Symbol: PSMC3IP
• Gene ID (NCBI): 29893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P2W1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMC3IP, also called HOP2, encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis.