PSMD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PSMD1 Polyclonal antibody, PBS Only (31912-1-PBS)

• 

  WB analysis using 31912-1-AP (same clone as 31912-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31912-1-AP (PSMD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31912-1-PBS in a different storage buffer formulation.

PSMD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31912-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31912-1-PBS targets PSMD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36142

  Product name: Recombinant human PSMD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-396 aa of BC094720

  Sequence: NDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARA

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
• Calculated Molecular Weight: 953 aa, 106 kDa
• Observed Molecular Weight: 106 kDa
• GenBank Accession Number: BC094720
• Gene Symbol: PSMD1
• Gene ID (NCBI): 5707
• RRID: AB_3670140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q99460
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.