PSMD5 Polyclonal antibody

• 

  WB analysis of HeLa using 11469-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11469-1-AP (PSMD5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11469-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11469-1-AP (PSMD5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 11469-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11469-1-AP (PSMD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 11469-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11469-1-AP (PSMD5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 11469-1-AP

  IP result of anti-PSMD5 (IP:11469-1-AP, 4ug; Detection:11469-1-AP 1:1000) with mouse liver tissue lysate 4000 ug.

• 

  IHC staining of human prostate cancer using 11469-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11469-1-AP (PSMD5 antibody) at dilution of 1:100 (under 10x lens).

PSMD5 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11469-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

26S protease subunit S5 basic, 26S proteasome subunit S5B, KIAA0072, PSMD5, S5B

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, human liver tissue, mouse liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11469-1-AP targets PSMD5 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2026

  Product name: Recombinant human PSMD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 154-504 aa of BC014478

  Sequence: LTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
• Calculated Molecular Weight: 504 aa, 56 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC014478
• Gene Symbol: PSMD5
• Gene ID (NCBI): 5711
• RRID: AB_2170648
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16401
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMD5, also named as KIAA0072, belongs to the proteasome subunit S5B/HSM3 family. It acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly, it is part of an intermediate PSMD5:PSMC2:PSMC1:PSMD2 module which probably assembles with a SMD10:PSMC4:PSMC5:PAAF1 module followed by dissociation of PSMD5. (PMID:15489334). This antibody is specific to PSMD5.