PSMD5 Monoclonal antibody, PBS Only

• 

  WB analysis of pig liver using 67682-1-Ig (same clone as 67682-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67682-1-Ig (PSMD5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67682-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67682-1-Ig (same clone as 67682-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67682-1-Ig (PSMD5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67682-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HCT 116 using 67682-1-Ig (same clone as 67682-1-PBS)

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 67682-1-Ig (PSMD5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67682-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit liver using 67682-1-Ig (same clone as 67682-1-PBS)

  rabbit liver tissue were subjected to SDS PAGE followed by western blot with 67682-1-Ig (PSMD5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67682-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 67682-1-Ig (same clone as 67682-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67682-1-Ig (PSMD5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67682-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67682-1-Ig (same clone as 67682-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67682-1-Ig (PSMD5 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67682-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67682-1-Ig (same clone as 67682-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67682-1-Ig (PSMD5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67682-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67682-1-Ig (same clone as 67682-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using PSMD5 antibody (67682-1-Ig, Clone: 1D5F7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 67682-1-PBS in a different storage buffer formulation.

PSMD5 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67682-1-PBS

Clone No.1D5F7

Host / Isotype

Mouse / IgG3

Reactivity

Human, pig, rat, rabbit, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

26S protease subunit S5 basic, 26S proteasome subunit S5B, KIAA0072, PSMD5, S5B

---

Product Information

67682-1-PBS targets PSMD5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, pig, rat, rabbit, mouse samples.

• Tested Reactivity: Human, pig, rat, rabbit, mouse
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19298

  Product name: Recombinant human PSMD5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 154-504 aa of BC014478

  Sequence: LTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
• Calculated Molecular Weight: 504 aa, 56 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC014478
• Gene Symbol: PSMD5
• Gene ID (NCBI): 5711
• RRID: AB_2882875
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16401
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.