PSME1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PSME1 Polyclonal antibody, PBS Only (10543-1-PBS)

• 

  WB analysis of mouse spleen using 10543-1-AP (same clone as 10543-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 10543-1-AP (PSME1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10543-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 10543-1-AP (same clone as 10543-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 10543-1-AP (PSME1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10543-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 10543-1-AP (same clone as 10543-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 10543-1-AP (PSME1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10543-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10543-1-AP (same clone as 10543-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10543-1-AP (PSME1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10543-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10543-1-AP (same clone as 10543-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10543-1-AP (PSME1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10543-1-PBS in a different storage buffer formulation.

PSME1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10543-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10543-1-PBS targets PSME1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0831

  Product name: Recombinant human PSME1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-249 aa of BC007503

  Sequence: MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

• Full Name: proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 29-33 kDa
• GenBank Accession Number: BC007503
• Gene Symbol: PSME1
• Gene ID (NCBI): 5720
• RRID: AB_2170944
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06323
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The principal function of the proteasome is targeted degradation of intracellular proteins. Activity of the 20S proteasome is controlled by regulatory complexes that bind to the ends of the cylindrical proteasome. 11S regulator (REG or PA28), is a complex of 28 kDa subunits that is thought to activate proteasomes toward the production of antigenic peptides. Human PSME1 and PSME2 genes encode the two proteasome activators PA28 alpha and beta, respectively, which have been implicated in antigen processing for loading class I MHC molecules. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.