PSMG1 Polyclonal antibody

• 

  WB analysis using 10335-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10335-1-AP (PSMG1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10335-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10335-1-AP (PSMG1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 10335-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10335-1-AP (PSMG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 10335-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10335-1-AP (PSMG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PSMG1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10335-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

C21 LRP, C21LRP, DSCR2, LRPC21, PAC 1, PAC1, PSMG1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HepG2 cells, Jurkat cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

10335-1-AP targets PSMG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0303

  Product name: Recombinant human PSMG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-249 aa of BC003619

  Sequence: VWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEA

• Full Name: proteasome (prosome, macropain) assembly chaperone 1
• Calculated Molecular Weight: 288 aa, 33 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC003619
• Gene Symbol: PSMG1
• Gene ID (NCBI): 8624
• RRID: AB_2877733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95456
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Stem Cell Res Ther; Melatonin induces the rejuvenation of long-term ex vivo expanded periodontal ligament stem cells by modulating the autophagic process.; Authors - Yi-Zhou Tan
		Oncol Rep; Association of p53/p21 expression and cigarette smoking with tumor progression and poor prognosis in non-small cell lung cancer patients.; Authors - Deyao Xie
		iScience; Elabela inhibits TRAF1/NF-κB induced oxidative DNA damage to promote diabetic foot ulcer wound healing; Authors - Yinghui Hong