PSMG4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PSMG4 Polyclonal antibody (31201-1-AP)

• 

  WB analysis using 31201-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31201-1-AP (PSMG4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 31201-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using PSMG4 antibody (31201-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

PSMG4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31201-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

bA506K6.2, C6orf86, hPAC4, PAC 4, PAC4

---

Tested Applications

• Positive WB detected in: A431 cells, MCF-7 cells, MDA-MB-231 cells, SK-BR-3 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31201-1-AP targets PSMG4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35222

  Product name: Recombinant human PSMG4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-123 aa of NM_001128591.1

  Sequence: MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF

• Full Name: proteasome (prosome, macropain) assembly chaperone 4
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: NM_001128591.1
• Gene Symbol: PSMG4
• Gene ID (NCBI): 389362
• RRID: AB_3669898
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5JS54
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMG4 (Proteasome assembly chaperone 4), also known as C6orf86. It is expected to be located in the nucleus and cytoplasm, which interacts with PSMG3 and asociates with alpha subunits of the 20S proteasome. The molecular weight of PSMG4 is 13 kDa.