PSPH Monoclonal antibody, PBS Only

• 

  WB analysis using 68500-1-Ig (same clone as 68500-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68500-1-Ig (PSPH antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68500-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 68500-1-Ig (same clone as 68500-1-PBS)

  WB result of PSPH antibody (68500-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSPH transfected A375 cells. This data was developed using the same antibody clone with 68500-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 68500-1-Ig (same clone as 68500-1-PBS)

  IP result of anti-PSPH (IP:68500-1-Ig, 4ug; Detection:68500-1-Ig 1:5000) with HL-60 cells lysate 2440 ug. This data was developed using the same antibody clone with 68500-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 68500-1-Ig (same clone as 68500-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 68500-1-Ig (PSPH antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68500-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68500-1-Ig (same clone as 68500-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PSPH antibody (68500-1-Ig, Clone: 1B12G3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68500-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PSPH Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 68500-1-PBS

Clone No.1B12G3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

1B12G3, EC:3.1.3.3, L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, PSP

---

Product Information

68500-1-PBS targets PSPH in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6070

  Product name: Recombinant human PSPH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-225 aa of BC063614

  Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

• Full Name: phosphoserine phosphatase
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC063614
• Gene Symbol: PSPH
• Gene ID (NCBI): 5723
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78330
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSPH (phosphoserine phosphatase) is an enzyme, which is involved in the process of L-serine biosynthesis. PSPH mainly plays role in multiple aspects of cell behaviours such as proliferation and differentiation by producing precursors for the biosynthesis of diverse compounds including neurotransmitters, glycolipids and thymidine (PMID: 11237721, PMID: 19963421). Additionally, augmented PSPH level is correlated with the prognosis in multiple cancers including cutaneous squamous cell carcinoma (PMID: 21726982), breast cancer (PMID: 28931725), non-small cell lung cancer (PMID: 30662358), colorectal cancer (PMID: 24146633) and hepatocellular carcinoma (PMID: 25793315).