PTCD3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PTCD3 Polyclonal antibody (25158-1-AP)

PTCD3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 25158-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, CoIP, RIP, ELISA

Synonyms

PTCD3, TRG 15

• 

  WB analysis of mouse embryo using 25158-1-AP

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 25158-1-AP (PTCD3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 25158-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 25158-1-AP (PTCD3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat kidney using 25158-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 25158-1-AP (PTCD3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 25158-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25158-1-AP (PTCD3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 25158-1-AP

  IP result of anti-PTCD3 (IP:25158-1-AP, 4ug; Detection:25158-1-AP 1:600) with HEK-293 cells lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 25158-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 25158-1-AP (PTCD3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PTCD3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse embryo tissue, HEK-293 cells, rat heart tissue, rat kidney tissue
• Positive IP detected in: HEK-293 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25158-1-AP targets PTCD3 in WB, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18330

  Product name: Recombinant human PTCD3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 368-689 aa of BC011832

  Sequence: SLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAMSICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDLICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADIKSAYESQPIRQTAQDWPATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTALTSDSDTDSSSDSDSDTSEGK

• Full Name: Pentatricopeptide repeat domain 3
• Calculated Molecular Weight: 689 aa, 79 kDa
• Observed Molecular Weight: 78-80 kDa
• GenBank Accession Number: BC011832
• Gene Symbol: PTCD3
• Gene ID (NCBI): 55037
• RRID: AB_2879931
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PTCD3 polyclonal antibody (Cat# 25158-1-AP) has 7 citations published in Cell Death & Disease, Nature Structural & Molecular Biology, EMBO Molecular Medicine, iScience, Biomedicines, FASEB Journal, and Journal of General Virology. Research fields span mitochondrial ribosome assembly and dysfunction, hepatocellular carcinoma, cognitive impairment via mitochondrial damage, pulmonary emphysema, colorectal cancer metastasis through m6A modification, and antiviral immunity against cytomegalovirus.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; MRPS31 loss is a key driver of mitochondrial deregulation and hepatocellular carcinoma aggressiveness.; Authors - Seongki Min
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia
mouse	WB	EMBO Mol Med; Hyperglycemia impairs cognitive function by inducing mitochondrial damage through lactylation of LRPPRC at K223.; Authors - Jingxi Xu
		iScience; Supernumerary proteins of the human mitochondrial ribosomal small subunit are integral for assembly and translation; Authors - Taru Hilander
human	WB	Biomedicines; Mitochondrial Ribosome Dysfunction in Human Alveolar Type II Cells in Emphysema; Authors - Loukmane Karim
human	RIP,CoIP	FASEB J; Epigenetic Activation of PTCD3 Promotes CRC Glutamine Metabolism and Metastasis via IGF2BP2-Mediated SLC38A2 m6A Modification; Authors - Weihui Peng