PTCHD4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PTCHD4 Polyclonal antibody (33489-1-AP)

• 

  WB analysis using 33489-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33489-1-AP (PTCHD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 33489-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 33489-1-AP (PTCHD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 33489-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 33489-1-AP (PTCHD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PTCHD4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33489-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

C6orf138, p53-regulated patched protein, Patched domain-containing protein 4, PTCH53

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33489-1-AP targets PTCHD4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37091

  Product name: Recombinant human C6orf138 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 150-323 aa of BC137359

  Sequence: SDGANIINLLASDSPSVSYAMVQQKYFSNYSPVIGFYVYEPLEYWNSSVQDDLRRLCSGFTAVSWVEQYYQFLKVSNVSANNKSDFISVLQSSFLKKPEFQHFRNDIIFSKAGDESNIIASRLYLVARTSRDKQKEITEVLEKLRPLSLSKSIRFIVFNPSFVFMDHYSLSVTV

• Full Name: chromosome 6 open reading frame 138
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC137359
• Gene Symbol: C6orf138
• Gene ID (NCBI): 442213
• RRID: AB_3742990
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZW05
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTCHD4 (Patched Domain-Containing Protein 4; formerly C6orf138) is a 96 kDa multi-pass transmembrane protein encoded at 6p12.3 that belongs to the Patched family of cholesterol/lipid transporters .