Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-83421 targets PTDSS1 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14170 Product name: Recombinant human PTDSS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 394-473 aa of BC002376 Sequence: TTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK Predict reactive species |
| Full Name | phosphatidylserine synthase 1 |
| Calculated Molecular Weight | 473 aa, 56 kDa |
| GenBank Accession Number | BC002376 |
| Gene Symbol | PTDSS1 |
| Gene ID (NCBI) | 9791 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48651 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Phosphatidylserine Synthase-1 (PTDSS1 or PSS1) is one of two enzymes involved in the production of phosphatidylserine (PS), which is a quantitatively minor, but physiologically important phospholipid in mammalian cells (PMID: 24241535). Mice lacking either Ptdss1 or Ptdss2 are viable, phenotypically normal and fertile, indicating that, in mice, PSS1 and PSS2 can compensate for each other (PMID: 18343815).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 PTDSS1 antibody CL488-83421 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

