PTEN Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HeLa using 80718-7-RR (same clone as 80718-7-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PTEN antibody (80718-7-RR, Clone: 240134F7 ) at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 80718-7-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 80718-7-RR (same clone as 80718-7-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug PTEN Recombinant antibody (80718-7-RR, Clone:240134F7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 80718-7-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 80718-7-PBS

  Biolayer interferometry (BLl) kinetic assays of 80718-7-RR against Human PTEN were performed. The affinity constant is below 1 pM.

PTEN Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 80718-7-PBS

Clone No.240134F7

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

10q23del, BZS, MHAM, MMAC1, phosphatase and tensin homolog, PTEN, PTEN1, TEP1

---

Product Information

80718-7-PBS targets PTEN in IF/ICC, FC (Intra), ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17274

  Product name: Recombinant human PTEN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 204-403 aa of BC005821

  Sequence: PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK

• Full Name: phosphatase and tensin homolog
• Calculated Molecular Weight: 47 kDa
• GenBank Accession Number: BC005821
• Gene Symbol: PTEN
• Gene ID (NCBI): 5728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P60484
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.